Computational Prediction of Leishmania Infantum Epitopes: A Bioinformatic-based Step to Leishmaniasis Vaccine Design
Published 2024 Article ID:e0109
10.30699/jovm.006.e0109
Published 2024 Article ID:e0109
10.30699/jovm.006.e0109
Leishmaniasis, a significant public health concern in resource-limited areas, is caused by the parasitic protozoan Leishmania. The insufficiency of current treatments underscores the urgent need for effective vaccines. Researchers have pinpointed promising vaccine targets through comprehensive antigen screening methods, showing their ability to trigger protective immune responses against Leishmania. The delicate balance between pro-inflammatory (Th1) and anti-inflammatory (Th2) responses in Leishmaniasis underscores the immune regulation complexity vital for fighting the infection. Leveraging bioinformatics tools, a multi-epitope vaccine (LIDVC) targeting KMP11, GP63, and LACK antigens aims to induce both humoral and cellular responses. In silico analysis suggests the potential of LIDVC to bolster protective immunity against Leishmania, offering a new path for vaccine development in tackling this formidable disease.
Highlights
Leishmaniasis, a significant public health concern in resource-limited areas, is caused by the parasitic protozoan Leishmania. The insufficiency of current treatments underscores the urgent need for effective vaccines.
Leishmaniasis, a neglected tropical disease caused by the protozoan parasite Leishmania, affects millions globally, particularly in resource-limited regions (1). The intricate life cycle of Leishmania involves transmission via infected sandfly bites, resulting in diverse clinical manifestations ranging from cutaneous to visceral forms of the disease (Figure 1). The inadequacy of current treatment options underscores the urgent requirement for efficacious and safe vaccines to manage and prevent Leishmaniasis (2). Researchers have directed their efforts towards identifying antigenic proteins expressed at various stages of the parasite's life cycle to uncover novel vaccine targets through high-throughput and highly accurate methods (3, 4). This pursuit has uncovered several promising vaccine candidates, such as glycoprotein 46 (gp46), cathepsin L-like and B-like proteases, histone H2A, glucose-regulated protein 78 (grp78), and stress-inducible protein 1 (STI-1) (5). These antigens have demonstrated the ability to provoke protective immune responses against Leishmania infection in preclinical investigations. The immune response to Leishmania infection is intricate, involving a delicate equilibrium between pro-inflammatory (Th1) and anti-inflammatory (Th2) cytokines (6, 7). Th1-mediated responses, characterized by IFN-γ production, play a pivotal role in controlling parasite growth by activating macrophages to eliminate intracellular parasites (4, 7). Conversely, Th2-mediated responses can support parasite survival and disease progression. Understanding the interplay between these immune responses is vital for designing effective vaccines against Leishmaniasis. The field of bioinformatics and computational biology has transformed vaccine development by facilitating the prediction of immunodominant epitopes and antigenic proteins. In silico methodologies enable swift screening of potential vaccine candidates, reducing the time and resources needed for experimental validation (3). Leveraging these computational tools, researchers can craft epitope prediction that target specific immune pathways to bolster protective immunity against Leishmania. In a recent study, epitopes were devised for KMP11, GP63, and LACK antigens using specific bioinformatic tools.

Figure 1. Transmission and life cycle of Leishmania infantum in the vector and host body. (Design by Authors, 2024)
2-1- Obtain the amino acid sequence for the target proteins
The FASTA-formatted amino acid sequences for L. infantum GP63 (Accession no. QJF54184), KMP11 (Accession no. AGV77135), and LACK (Accession no. UQI50440) were collected from the National Center for Biotechnology Information (NCBI) website located at http://www.ncbi.nlm.nih.gov (8).
2-2- Forecasting the location of antigenic epitopes
In this step we opted to predict CTL epitopes, linear B cell epitopes, and MHC class I and II epitopes. To do this, different bioinformatics servers capable of identifying these sorts of epitopes were used.
a. Prediction and screening of linear B cell epitope:
Linear B cell epitopes were predicted utilizing the (B cell epitope prediction) section of the IEDB server which located at http://tools.iedb.org/bcell/ . The mentioned server method was also set to Bepipred Linear Epitope Prediction 2.0. BepiPred is a predictive method that identifies the location of linear B-cell epitopes. It achieves this by utilizing a hidden Markov model and propensity scale method, which allow it to determine which residues are part of an epitope based on their scores. Residues with scores higher than the threshold value of 0.35 are colored yellow on the graph and labeled with "E" in the output table. The accuracy of the prediction method for epitope/non-epitope predictions is determined by a table that summarizes data from a large benchmark calculation that included almost 85 B cell epitopes (9).
a. Prediction and screening of linear B cell epitope:
Linear B cell epitopes were predicted utilizing the (B cell epitope prediction) section of the IEDB server which located at http://tools.iedb.org/bcell/ . The mentioned server method was also set to Bepipred Linear Epitope Prediction 2.0. BepiPred is a predictive method that identifies the location of linear B-cell epitopes. It achieves this by utilizing a hidden Markov model and propensity scale method, which allow it to determine which residues are part of an epitope based on their scores. Residues with scores higher than the threshold value of 0.35 are colored yellow on the graph and labeled with "E" in the output table. The accuracy of the prediction method for epitope/non-epitope predictions is determined by a table that summarizes data from a large benchmark calculation that included almost 85 B cell epitopes (9).
b. Cytotoxic T lymphocyte (CTL) epitope prediction and screening:
In this section we used CTLPRED server to predict the CTL epitopes which available at http://crdd.osdd.net/raghava/ctlpred/ . The approach of this server based on two form of machine learning techniques such as Artificial Neural network (ANN) and support vector machine (SVM). Based on these two processes of server, the methods also allow for consensus and combined prediction (10).
c. Prediction and selection approach for MHC class 1 and MHC class 2 epitopes:
To predict MHC class 1 epitopes, we utilized the T cell class I tool provided on the IEDB website at https://nextgen-tools.iedb.org/. The tool employs Artificial Neural Networks (ANNs) and utilizes data on 177 MHC molecules from various species such as humans, mice, cattle, primates, pigs, horses, and dogs. The IEDB recommends using percentile rank as the primary metric for ranking binding predictions, with a percentile rank of less than or equal to 1% covering 80% of the immune response for many alleles (11). In the following to anticipate MHC class 2 epitopes, the MHC2PRED at http://crdd.osdd.net/raghava/mhc2pred/ address was used. In the algorithm of this server, Support Vector Machine (SVM), a machine learning approach, was used to construct a prediction strategy for MHC binding. Individual amino acid sequences represented by binary input were used to train SVM. Each amino acid in a 9-mer peptide was turned into a 20-dimensional vector, giving each peptide a 180-dimensional vector. Non-binders were classified as -1, whereas binders were designated as +1. Experimentation was used to identify the best kernel type for data categorization, such as RBF, Polynomial, Linear, and Sigmoid. Finally, by methodically modifying the parameters and analyzing prediction performance, the kernel features and regulatory parameter C were then tuned (12).
3-1- Predicted epitopes
a. B-Cell Epitope Prediction:
The high-scored linear and conformational B-cell epitopes that were predicted within the full-length of the designed vaccine by the IEDB, also in combination with BepiPred linear epitope prediction 2.0, respectively (Table 1).
Table 1. B-cell epitopes predicted by the IEDB
| Antigen | Start | End | Peptide | Length |
KMP11 |
7 | 7 | E | 1 |
| 9 | 10 | SA | 2 | |
| 13 | 14 | KR | 2 | |
| 16 | 76 | DEEFNRKMQALNAKFFADKPDESTLSPEMKE HYEKFERMIKEHTEKFNKKMHEHSEHFKQK |
61 | |
| 78 | 89 | AELLEQQKAAQY | 12 | |
LACK |
29 | 48 | NPDRHSVDSDYGLPSHRLEG | 20 |
| 81 | 90 | NGQCQRKFLK | 10 | |
| 125 | 135 | CMHEFLRDGHE | 11 | |
| 168 | 178 | GGKCERTLKGH | 11 | |
GP63 |
16 | 20 | QLHTE | 5 |
| 23 | 56 | KVRQVQDKWNATGMVDEICGDFKVPPAHITEGFS | 34 | |
| 83 | 86 | FSDG | 4 | |
| 100 | 106 | IASRYDQ | 7 | |
| 126 | 144 | FFEGARILESISNVRHKDF | 19 | |
| 172 | 191 | IEDQGGAGSAGSHIKMRNAQ | 20 | |
| 217 | 219 | FYQ | 3 |
b. CTL Epitopes Prediction
The high-ranked CTL epitopes (9-mer length) with a binding affinity score were selected as final CTL epitopes in three antigens (Table 2).
Table 2. Cytotoxic T-lymphocyte (CTL) epitopes of selected antigens prediction using CTLpred server (Combined approach; Cutoff Score=0.51).
| Antigen | Position | Sequence | Score (ANN/SVM) |
KMP11 |
7 | FFADKPDES | 0.990 |
| 9 | KFFADKPDE | 0.980 | |
| 13 | RLDEEFNRK | 0.950 | |
Lack |
16 | SHRLEGHTG | 1.000 |
| 78 | KFLKHTKDV | 1.000 | |
| 29 | FVSCVSLAH | 0.990 | |
GP63 |
81 | RILESISNV | 1.000 |
| 125 | PQALQLHTE | 0.990 | |
| 168 | VRQVQDKWN | 0.990 |
c. MHC Peptide Prediction
To predict the binding epitopes for Major Histocompatibility Complex (MHC) class I, we utilized the next-generation tools of Immune Epitope Database (IEDB, available at https://nextgen-tools.iedb.org/tc1) and focused on 9-mer length peptides and human HLAs. Specifically, based on IEDB recommended method 2020.09 (NetMHCpan EL 4.1) (13), most reference HLA allele set used for prediction; e.g. 16 class A alleles (01:01, 02:01, 02:03, 02:06, 03:01, 11:01, 23:01, 24:02, 26:01, 30:01, 30:02, 31:01, 32:01, 33:01, 68:01 and 68:02) and 11 class B alleles (07:02, 08:01, 15:01, 35:01, 40:01,44:02, 44:03, 51:01, 53:01, 57 l:01 and 58:01) (Table 3-5).
Table 3. B-cell epitopes predicted by the IEDB
| Peptide | Length | Start | End | Allele | Peptide index | Core | Icore | Score |
| KMHEHSEHF | 9 | 65 | 73 | HLA-B*15:01 | 1577 | KMHEHSEHF | KMHEHSEHF | 0.960679 |
| HFKQKFAEL | 9 | 72 | 80 | HLA-B*08:01 | 1500 | HFKQKFAEL | HFKQKFAEL | 0.955418 |
| LEQQKAAQY | 9 | 81 | 89 | HLA-B*44:03 | 1929 | LEQQKAAQY | LEQQKAAQY | 0.907147 |
| LEQQKAAQY | 9 | 81 | 89 | HLA-B*44:02 | 1845 | LEQQKAAQY | LEQQKAAQY | 0.901512 |
| MIKEHTEKF | 9 | 54 | 62 | HLA-B*15:01 | 1566 | MIKEHTEKF | MIKEHTEKF | 0.889601 |
| RMIKEHTEK | 9 | 53 | 61 | HLA-A*03:01 | 389 | RMIKEHTEK | RMIKEHTEK | 0.864294 |
| EFNRKMQAL | 9 | 18 | 26 | HLA-B*08:01 | 1446 | EFNRKMQAL | EFNRKMQAL | 0.828076 |
Table 4. B-cell epitopes predicted by the IEDB
| Peptide | Length | Start | End | Allele | Peptide index | Core | Icore | Score |
| HPIVVSGSW | 9 | 149 | 157 | HLA-B*53:01 | 5093 | HPIVVSGSW | HPIVVSGSW | 0.942054 |
| RTLKGHSNY | 9 | 173 | 181 | HLA-A*30:02 | 2233 | RTLKGHSNY | RTLKGHSNY | 0.91673 |
| TLKGHSNYV | 9 | 174 | 182 | HLA-A*02:03 | 586 | TLKGHSNYV | TLKGHSNYV | 0.913724 |
| RTLKGHSNY | 9 | 173 | 181 | HLA-B*57:01 | 5323 | RTLKGHSNY | RTLKGHSNY | 0.856624 |
| KVWNVNGGK | 9 | 162 | 170 | HLA-A*03:01 | 986 | KVWNVNGGK | KVWNVNGGK | 0.83114 |
Table 5. B-cell epitopes predicted by the IEDB
| Peptide | Length | Start | End | Allele | Peptide index | Core | Icore | Score |
| KVRQVQDKW | 9 | 23 | 31 | HLA-B*57:01 | 5398 | KVRQVQDKW | KVRQVQDKW | 0.991967 |
| YLIPQALQL | 9 | 9 | 17 | HLA-A*02:01 | 224 | YLIPQALQL | YLIPQALQL | 0.989888 |
| YLIPQALQL | 9 | 9 | 17 | HLA-A*02:03 | 439 | YLIPQALQL | YLIPQALQL | 0.967609 |
| YLIPQALQL | 9 | 9 | 17 | HLA-A*02:06 | 654 | YLIPQALQL | YLIPQALQL | 0.966576 |
| KVRQVQDKW | 9 | 23 | 31 | HLA-B*58:01 | 5613 | KVRQVQDKW | KVRQVQDKW | 0.963771 |
| RILESISNV | 9 | 131 | 139 | HLA-A*02:06 | 776 | RILESISNV | RILESISNV | 0.956299 |
| HEMAHALGF | 9 | 114 | 122 | HLA-B*44:03 | 4844 | HEMAHALGF | HEMAHALGF | 0.938416 |
| RILESISNV | 9 | 131 | 139 | HLA-A*02:01 | 346 | RILESISNV | RILESISNV | 0.923092 |
| FSNTDFVMY | 9 | 55 | 63 | HLA-A*01:01 | 55 | FSNTDFVMY | FSNTDFVMY | 0.911191 |
| HEMAHALGF | 9 | 114 | 122 | HLA-B*44:02 | 4629 | HEMAHALGF | HEMAHALGF | 0.910567 |
For MHC class II binding epitopes, we employed the MHC2PRED server and selected several peptides for each antigen, ensuring that they had a percentile rank of ≤1 and an IC50 value of ≤50. These stringent criteria were used to identify peptides with high binding scores for MHC class I and II. The specific peptides and their corresponding binding scores can be found in Table 6-8.
Table 6. B-cell epitopes predicted by the IEDB
| Allele | Sequence | Residue No. | Peptide Score |
HLA-DR9 |
RTEINLEIS | 24 | 1.245 |
| KFERMIKEH | 95 | 1.185 | |
| EPRTEINLE | 22 | 1.182 | |
| FNRKMQALN | 64 | 1.176 | |
HLA-DR3 |
EEFSAPFKR | 51 | 1.888 |
| RLDEEFNRK | 59 | 1.546 | |
| HEHSEHFKQ | 112 | 1.325 | |
| TEKFNKKMH | 104 | 1.26 | |
HLA-DQ7 |
GVKINETPL | 2 | 1.439 |
| EMRANEPRT | 17 | 1.413 | |
| EFSAPFKRL | 52 | 1.375 | |
| NIAINFANT | 36 | 1.084 | |
HLA-DQ8 |
RKMQALNAK | 66 | 2.077 |
| EPRTEINLE | 22 | 1.736 | |
| ISHMANIAI | 31 | 1.675 | |
| KQKFAELLE | 119 | 1.618 | |
HLA-DRB1*0901 |
PRTEINLEI | 23 | 1.452 |
| STLSPEMKE | 83 | 1.432 | |
| HEHSEHFKQ | 112 | 1.415 | |
| DESTLSPEM | 81 | 1.353 | |
HLA-DRB1*0401 |
FANTMMATT | 41 | 1.556 |
| GVKINETPL | 2 | 1.136 | |
| YEKFERMIK | 93 | 1.099 | |
| FFADKPDES | 75 | 1.024 |
Table 7. B-cell epitopes predicted by the IEDB
| MHC-II Alleles | Predicted Epitopes |
| IAb | VYDLESKAV, VTSLACPQQ, ATDYALTAS, GAALLWDLS, HKDNLIRVW |
| IAd | TAISWKANP, VATERSLSV, WVTSLACPQ, DRLIVSAGR, FSPDDRLIV |
| IAs | FVSCVSLAH, DGNTLYSGH, ICFSPSLEH, ATDYALTAS, RGWVTSLAC |
| IEd | RVWNVAGEC, RGWVTSLAC, FSPNRFWMC, RLIVSAGRD, VSCVSLAHA |
| MHC-II Alleles | Predicted Epitopes |
Table 8. B-cell epitopes predicted by the IEDB
| Allele | Sequence | Residue No. | Peptide Score |
HLA-DR9 |
KDFDVPVIN | 178 | 1.297 |
| KRDILVKYL | 38 | 1.272 | |
| SVPSEEGVL | 102 | 1.261 | |
| VDEICGDFK | 73 | 1.246 | |
HLA-DRB1*0101 |
NIAINFANT | 27 | 2.215 |
| VINIPAANI | 128 | 1.671 | |
| AINFANTMK | 29 | 1.52 | |
| LIPQALQLH | 46 | 1.507 | |
HLA-DQ7 |
SSTAVAKAR | 187 | 1.632 |
| IPQALQLHT | 47 | 1.415 | |
| IPAANIASR | 131 | 1.213 | |
| PVINSSTAV | 183 | 1.163 | |
HLA-DQ8 |
CDTLEYLEI | 200 | 1.921 |
| MKKRDILVK | 36 | 1.864 | |
| ISHMANIAI | 22 | 1.675 | |
| KKRDILVKY | 37 | 1.574 | |
HLA-DR13 |
VINIPAANI | 128 | 1.468 |
| HPAVGVINI | 123 | 1.271 | |
| VGFFEGARI | 160 | 1.269 | |
| VGVINIPAA | 126 | 1.267 | |
I-Ag7 |
MAPAAAAGY | 231 | 1.903 |
| ELMAPAAAA | 229 | 1.857 | |
| NIPAANIAS | 130 | 1.814 | |
| GFFEGARIL | 161 | 1.785 |
In summary, this process involved predicting and selecting potential binding epitopes for both MHC class I and II, using different servers and criteria to identify peptides with strong binding affinity to human HLAs.
Leishmaniasis is widespread in subtropical regions, causing a significant burden annually (14). In spite of various chemotherapy and drug therapy against leishmaniasis which have some side effects, recent advances in development of efficacious vaccines seems to be an appropriate outstanding preventive strategy for improvement of the public health and infectious diseases control (15-17).
Epitope-prediction is the first and most basic step in the design of multi-epitopic vaccines. Today, with the advancement of new methods in epitope mapping, computer tools have increased the accuracy and speed of this process.
In order to make these predictions as accurate as possible, after determining the immunogenic proteins in Leishmania infantum, all three prediction modes of linear B-cell epitopes, CTL epitopes and epitopes of MHC class 1 and 2 should be determined.
The authors are grateful to the Smart University of Medical Sciences and the technical team of JoVm for their support and we would like to acknowledge BioinfCamp.com for providing basic training along the way for this article.
Not applicable.
The authors declared no conflict of interest.
This research received no specific grant from any funding agency in the public.